Dataset for protein Unclassified of organism Oreochromis niloticus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A669CUF8_unc070L-01 Putative 070L protein OS=[Eukaryota] Oreochromis niloticus (length=224 residues).
MVYVGGTRDKHHCYTCGLTLKDFVVGDTLLGEHIYHVYNKGMACRYIERKYSKGEILYILGKERYRRGQMAFPSLIDKAE
FGYSSVEGLYRCILCSATIFQSASLRVMKQAVREVLWKYRRQYAGMLSNQKSVEVHMVTKVAREMCSDGIINWGRIVSLV
AFGEVLCRALKTTLGRHCAHEVGGGFIELFDRPSGRNFLLIQGVLIIVLLGLSLFTFLPCTTMK
© 1998-2020Legal notice