Dataset for protein Unclassified of organism Lymphocystis disease virus 4

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A6B9XM53_unc070L-01 Putative 070L protein OS=[Viruses] Lymphocystis disease virus 4 (length=181 residues).
MYLNNINMSNEFETNTKQLVDTFFIKYFDLKESDDMILKIMKREVDNLFNKHRLVYVNMLTKIMTMNIEVEIFVKEIVEN
IFSDGLINWGRIISLITFGILIVDYLKMINMTDKIKTVSFIISSYLIEHQKQWLLENNAWTGLVDFFTVQDHTSHIKSPL
TLFIALISIGALLYSTFNLAH
© 1998-2020Legal notice