Dataset for protein Unclassified of organism Lymphocystis disease virus 2

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A6F8X2N8_unc070L-01 Putative 070L protein OS=[Viruses] Lymphocystis disease virus 2 (length=173 residues).
MSNKFETDTKYLIDAFFKEYFNSQESNDIILKTIKKEVNILFDKHRLVYSNMIIDISITTEIDILVKKTAESIFSDGLVN
WGRIISLITFGILIVEYLKTINNTDKITSVSTIISSYLIEHQKHWLIKNNAWIGLVDFFTVQTYTSPVKSLLTFFIVFMG
TGAMLYSAFNLTY
© 1998-2020Legal notice