Dataset for protein Unclassified of organism Frog virus 3

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A5B8P2Y9_unc097R-01 Putative 097R protein OS=[Viruses] Frog virus 3 (length=69 residues).
MVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPGQRLL
© 1998-2020Legal notice