Dataset for protein 097R of organism Common midwife toad virus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|H6WEE3_097R-01 097R protein OS=[Viruses] Common midwife toad virus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRMAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGVITGVVLSLLFS
© 1998-2022Legal notice