Dataset for protein Unclassified of organism Clytia hemisphaerica

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A7M5X572_unc070L-01 Putative 070L protein OS=[Eukaryota] Clytia hemisphaerica (length=178 residues).
MSPARTDLIVDGEFYQRTKFLANYVLKKHHNHTQRTDRIGDKLYELCLDIKYKHDMFFENVGRELGLNQENFDELSKAVM
AEVLNGNCNFGRIVSIYAFSLALSDYCIKNNLGDKTESITTNVALSIQEHIEWFNNHGQWDGFLDHFTPQTVEDKVWRGM
MITTFGLGAVAGLIYAHS
© 1998-2022Legal notice