Dataset for protein Unclassified of organism all

[Download (right click)]

42 sequence(s)

>gnl|bcl2dbpro|A0A068AAN3_uncA9-01 Putative A9 protein OS=[Viruses] Alcelaphine gammaherpesvirus 2 (length=165 residues).
MGEPEFQDNVLYYLFLDELNFVLIRNGFSCSHAKLIMDETRKRVTDYSEQFEVISKAVEPPEPESLGRIAASLLTPNPNW
GRLVAFFAYLAYLQRNSSHKVFTKNHIKQLKKIVKKHVVPWNSDLKGSKAKLPAPRQPLKSTLLLTAAASCLTFFLIYFR
SIRAK
>gnl|bcl2dbpro|A0A493T3B4_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Anas platyrhynchos platyrhynchos (length=89 residues).
LVVFAGTLAAALAERGCGDGPHRLAEALAAYLAEERGEWLREHGGWDGFCRFFGRHGSQPADQNSTISNAIMAAAGFGIA
GLAFLLVVR
>gnl|bcl2dbpro|W5LAB6_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Astyanax mexicanus (length=176 residues).
MSCWLRKETLALAEDYIRFCTGDQRTPPSESAEAMRRLAKEMERQHHSKFHSLSQSFLTACGADPSACLRSVMAVLVEDG
KLNWGRVVSLFTFTGVLATELFSRGDGPECCSRLAETIADYLGAENKEWLLENEGWEGFCKFVRRAGHLGQDSSMKTALF
AAAGVGIAGLTFLLVR
>gnl|bcl2dbpro|Q9YTQ0_uncVBCL2-01 Putative V-BCL-2 protein OS=[Viruses] Ateline herpesvirus 3 (length=174 residues).
MYIHSSSCYDISKKMSSITFQKTIESILNECQECHSQSDSIVRAIHSVIQQYNKFEDLMPDFSICAHDRIKFVGEAIMLT
TKHNTNWGKVVAMISFSVAALQTIDEDYRRVATSTLSSYIAKSVGVNWFIDHGGKKGLVEFCDTILSKSNVTFSVFLLPA
ILTVIILIGTLLIK
>gnl|bcl2dbpro|A0A060CXQ6_uncA9-01 Putative A9 protein OS=[Viruses] Bovine gammaherpesvirus 6 (length=173 residues).
MQFKDIEAGRVEEDRTEETDEAGCSDIFIHQLKLALIKGGIKYIYANWIIDTAKEKSAQLIEKFDSLSKDVEFSTPDDLK
LVLNSMFEDGVNLGRVTVFFAYVIYLHLKLEDCSFPDAHYTVIKETMDTYIIPWLQTNISSIKEMSSSIANVFATLVAPI
ALGIASMFLFQKG
>gnl|bcl2dbpro|Q993L0_uncBALF1-01 Putative BALF1 protein OS=[Viruses] Callitrichine gammaherpesvirus 3 (length=173 residues).
MTDDVFQDNAPNLGAEDEMDRGVLLLTRVMIAAYLDDPGKGLGTEERLFLRLIKRLMKKEEKRFADIVNSGSAPTTLHGH
IKRLMTFTRAIYEDHMDNWFRVRALTSLAVAYARRNIPGDSENAGLLLVGFAEFLCLYRRAWLSRLGGIRVGLRRAFPLT
WMRMRVGESCYKQ
>gnl|bcl2dbpro|A0A5B8FKL5_uncORF16-01 Putative ORF16 protein OS=[Viruses] Colobine gammaherpesvirus 1 (length=179 residues).
MDPDHPPPEVEDIRGILCVCGLEEPEYMEHPVISPIRVCVSSIMRRRARIFSQMINQFPILSTTGIERVGVGMLQMNADG
NMNWGRGLALLALACTVVRRVSGSRLLTEFALRVLPLYVYQAIGPNWFHAHGGWNGLRMYCRQFMEQQGNMRMFLLLTAA
GLVATVMALWLSSRQGPLG
>gnl|bcl2dbpro|E9M5Q5_uncM11-01 Putative M11 protein OS=[Viruses] Cricetid gammaherpesvirus 2 (length=172 residues).
MDNLTEWRSLLKVFLLKSSGCSCQGVSAGLLADVDVLDKLTTDFITKYESVYGKLPLTQSDWVNNITALLFFMLDKINFG
RFIGLFAVGKFVCQELLLSSTTWSMAHDLLFHKLALVLEVKIMPWLTSMGVGTFNELLGRHAGQVVQTRFFYFLKSMFVW
ACMQLLDPWPFT
>gnl|bcl2dbpro|Q8UWD5_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Danio rerio (length=176 residues).
MSCWLREQTLLLAEDYISFCSGIQQTPPSESAEAMRYLAKEMEQQHRTKFRSLSQEFLDTCGADPSKCLQSVMRELVGDG
KMNWGRVVSIFTFTGVLASELLSRGENSEGSRRLAETIADYLGGEKQDWLVENGGWEGFCRFFHNARQLNQESSMKTALF
AAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A4W4ETM5_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Electrophorus electricus (length=176 residues).
MSCWLRKETLVLAEDYIDFCTGIRRTPPSESAEAMRCLAKEMERQHLSKFRSLSQRLLGACGSDPSTCLRSVMAELVNDG
KLNWGRVVSLFTFTGVLATELFSRGEGPECCRSLAETIADYLGGEKRDWLEENEGWEGFCRFFRGMGHVGQESSMKTALF
AAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A0B6VHH4_uncBHRF1-01 Putative BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus (length=98 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGL
TLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|Q804D0_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Gallus gallus (length=177 residues).
MPGSLKEETALLLEDYFQHRAGGAALPPSATAAELRRAAAELERRERPFFRSCAPLARAEPREAAALLRKVAAQLEAEGG
LNWGRLLALVVFTGTLAAALAESGCEEGPSRLAAALAAYLAEEQGEWLEEHARWDGFCRFFGRHGSQPADQNSTLSNAIM
AAAGFGIAGLAFLLVVR
>gnl|bcl2dbpro|Q90ZN1_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Gallus gallus (length=177 residues).
MPGSLKEETALLLEDYFQHRAGGAALPPSATAAELRRAAAELERRERPFFRSCAPLARAEPREAAALLRKVAAQLEAEGG
LNWGRLLALVVFTGTLAAALAESGCEEGPSRLAAALAAYLAEEQGEWLEEHGGWDGFCRFFGRHGSQPADQNSTLSNAIM
AAAGFGIAGLAFLLVVR
>gnl|bcl2dbpro|A0A452I804_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Gopherus agassizii (length=146 residues).
AETLRRAASELESRERPFFRACRPLALDERQEPAALLSRVAEQLEAEGGLNWGRVLALVVFAGSLAAALAEQGSREEAGR
LAEVLASYLAEEKREWLEAHGGWDGFCHFFNGHGSQPTDQSSTISSAIMAAAGFGLAGLAVLLAVR
>gnl|bcl2dbpro|A0A0N9SCW9_uncORF16-01 Putative ORF16 protein OS=[Viruses] Human herpesvirus 8 (length=175 residues).
MDEDVLPGEVLAIEGIFMACGLNEPEYLYHPLLSPIKLYITGLMRDKESLFEAMLANVRFHSTTGINQLGLSMLQVSGDG
NMNWGRALAILTFGSFVAQKLSNEPHLRDFALAVLPVYAYEAIGPQWFRARGGWRGLKAYCTQVLTRRRGRRMTALLGSI
ALLATILAAVAMTRR
>gnl|bcl2dbpro|A0A0N9SEY2_uncORF16-01 Putative ORF16 protein OS=[Viruses] Human herpesvirus 8 (length=175 residues).
MDEDVLPGEVLAIEGIFMACGLNEPEYLYHPLLNPIKLYITGLMRDKESLFEAMLANVRFHSTTGINQLGLSMLQVSGDG
NMNWGRALAILTFGSFVAQKLSNEPHLRDFALAVLPVYAYEAIGPQWFRARGGWRGLKAYCTQVLTRRRGRRMTALLGSI
ALLATILAAVAMTRR
>gnl|bcl2dbpro|A0A7D3UXJ4_uncORF16-01 Putative ORF16 protein OS=[Viruses] Human herpesvirus 8 (length=175 residues).
MDEDVLPGEVLAIEGIFMACGLNEPEYLYHPLLSPIKLYITGLMRDKESLFEAMLANVRFHSTTGINQLGLSMLQVSGDG
NMNWGRALAILTFGSFVAQKLSNEPHLRDFALAVLPVYAYEAIGPQWFRARGGWQGLKAYCTQVLTRRRGRRMTALLGSI
ALLATILAAVAMSRR
>gnl|bcl2dbpro|W5N753_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Lepisosteus oculatus (length=531 residues).
MCDQTFLAINFGPCDKCQKTKPLMNIYIKSEPINYCALCVELMATEGLQESETLASLKNESETLKSKLEEERAKLHDVEL
HQVADRVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDAFTTNKEHAVTMPCTWVMACAYAPSGC
AVACGGLDNKCSVYPLTFDKNENMASKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHAADV
LSLDLAPSETGNTFVSGGCDKKAMVWDLRSGQCIQSFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYS
KESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGTRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRKMSCCLRE
QTLILARDYIDLCLGTTRQSPSPNAEAMRSLAKEMEKQYQSKFNSLLHSFIATCGPDPSVNLKKVMEELVGDGILNWGRV
VSLFTFTGLLARQLYAEGASIDCFKRLAETIADYLGGEKREWLIQNEGWVS
>gnl|bcl2dbpro|W5N753_uncvNR13-02 Putative vNR13 protein OS=[Eukaryota] Lepisosteus oculatus (length=395 residues).
MCDQTFLAINFGPCDKCQKTKPLMNIYIKSEPINYCALCVELMATEGLQESETLASLKNESETLKSKLEEERAKLHDVEL
HQVADRVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDAFTTNKEHAVTMPCTWVMACAYAPSGC
AVACGGLDNKCSVYPLTFDKNENMASKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHAADV
LSLDLAPSETGNTFVSGGCDKKAMVWDLRSGQCIQSFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYS
KESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGTRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRIWA
>gnl|bcl2dbpro|A0A0S0DWX8_uncBALF1-01 Putative BALF1 protein OS=[Viruses] Lymphocryptovirus Macaca/pfe-lcl-E3 (length=182 residues).
MQPAKSTDSVFVRTPVEAWVSPSPPDDKVAETSYLLFRAMYAVFTQDETDLPLPALVMCRLLKASLRKHRRMYAELACKT
ADLGGKHAHMQLIISVLRAVYDDHYDYWSRLRVVLCYTVVFAVRNYLDDHDSAAFVMGATAHYLALYRRLWFASLGGLPR
ALRRQFPVTWTVASLSTFLKSL
>gnl|bcl2dbpro|A0A3G1T4B1_uncBHRF1-01 Putative BamHI-H right reading frame protein OS=[Viruses] Macaca arctoides gammaherpesvirus 1 (length=190 residues).
MAYSTRDVLLALCIRDNHVHGTGGLHPVLELALREAPSSVSSANPLTLHMHGILEQIIAQNQATFVETWDRFLESTDDVD
RDFGRVFAEIFHRGDPSFGRALAWLAWCMHACRTLCSDQNTPYYLVDLSVRGMLEASSGLDGWISQQGGWLALLRGEHPA
SRSSRWTVFLAGLSLTLLVVCSYLFISRRH
>gnl|bcl2dbpro|Q53D42_uncORF16-01 Putative ORF16 protein OS=[Viruses] Macaca fuscata rhadinovirus (length=187 residues).
MAAIQGPPPLPEEENENSLPDDVYAIEGIFLYCGLGQAEYLHHPVFSPIKEFISSFLKDSARLYERLLRHTDYRSLRGLN
AIGQGMLHINTDGRHNWGRALAVLGLGAYVVDKIRDDERLLTFAIAVLPVYAYEALESQWFRSHGGWEGLRNYCERILRH
RRNARRHMCYGVAAGLLALVALFAIRR
>gnl|bcl2dbpro|Q9WRT6_uncORF16-01 Putative ORF16 protein OS=[Viruses] Macaca mulatta rhadinovirus 17577 (length=187 residues).
MAAVQGPPPPPEEENENSLPVDVYAIEGIFLYCGLGQAEYLHHPVFSPIKEFISAFLKDSARLYERLLRHTDYRSLRGLN
AIGQGMLQINTDGRHNWGRALAVLGLGAYVVDKVKDDERLLTFAIAVLPVYAYEALESQWFRSHGEWEGLRNYCERILRH
RRNARRHMCYGVAAGLLALVALFAIRR
>gnl|bcl2dbpro|A0A0B5CYR6_uncORF16-01 Putative ORF16 protein OS=[Viruses] Macaca nemestrina rhadinovirus 2 (length=184 residues).
MEAVRAPPPEEENDNSLPDDVYAIEGIFLYCGLGQAEYLHHPVFSPIKEFIRAFLKDSARLYERLLRNIDYRSMRGLNAI
GQGMLQINADGRHNWGRVLAVLGLGAYVVEKVMNDERLLTFAIAVLPVYAYEALESQWFRLHGGWEGLRNYCARILRHRR
NARHMCYGVAAGLLALVALFAMRR
>gnl|bcl2dbpro|A0A5J6XVA7_uncORF16-01 Putative ORF16 protein OS=[Viruses] Macacine gammaherpesvirus 5 (length=187 residues).
MAAVQGPPPPPEEENENSLPVDVYAIEGIFLYCGLGQAEYLHHPVFSPIKEFISAFLKDSARLYERLLRHTDYRSLRGLN
AIGQGMLQINTDGRHNWGRALAVLGLGAYVVDKVKDDERLLTFAIAVLPVYAYEALESQWFRSHGEWEGLRNYCERILRH
RRNARRHMCYGVAAGLLALVALFAIRR
>gnl|bcl2dbpro|A0A6I8NZN5_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Ornithorhynchus anatinus (length=199 residues).
MAGSLREQTALLVADYLAQCGPGPAPPAPPPSPAAATLRRAAAALRRQHRPFFVCARRRAGAGAGPGDRPGDGDGAGDGD
GDGAGPAALLAQVAAELDHDGGLNWGRVVALVALAGALLDPEPDPRTPDLSRTLADTLCHYLAEEKGDWLREHGGWDGFY
HFFNQPEGRPAEQNSAFCNAIMAAAGFGLAGLAFLLAVR
>gnl|bcl2dbpro|C1BL36_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Osmerus mordax (length=186 residues).
MSCRLWKETLALGEDYLAFCCASPRLAPPPPSEPAAAMRRLAQDMETLNSVSFQALSKNLLCHSEQDPCASLRAVLKEIV
VDGKLNWGRVVCIFTFTGVLARQLQEQKSKGQDIGQGPDKCRGLAEAIADFLGEEKKDWLQENGGWEGLCKFSDCARGMN
QDSSMKTALFAVAGVGIAGLTFLLGR
>gnl|bcl2dbpro|A0A3B3TEX4_uncvNR13-03 Putative vNR13 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=231 residues).
MVTETLIYTAGWESMLISSLDKKMGILKFACATGVVAAAAGAAYLYRRFRRTPEQEEVNMATSLQDETLVVANDYMDFCI
GIKRTPPSEFAKAMRYMAKKVENKHRSSLHQLVETFCRYGGFNTWTKLKNFMLDVFGGESTSWGEILILFAFAGILAVQL
STTDEDVACSRRLAEMISDVLEEKQEWMIQNGGWMGFMDYVHTVKPGYSESPLKKALPAAATVAIASLLVR
>gnl|bcl2dbpro|A0A3B3TEX4_uncvNR13-02 Putative vNR13 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=250 residues).
MGILKFACATGVVAAAAGAAYLYRRFRRTPEQEEVNMATSLQDETLVVANDYMDFCIGIKRTPPSEFAKAMRYMAKKVEN
KHRSSLHQLVETFCRYGGFNTWTKLKNFMLDVFGGESTSWGEILILFAFAGILAVQLSTTDEDVACSRRLAEMISDVLEE
KQEWMIQNGGWMGFMDYVHTVKPGYSESPLKKALPAAATVAIASLLVHRLSTKKNPTRLAPIFIFNPQETARNISLLDGT
FYQKHALSVL
>gnl|bcl2dbpro|A0A3B3TEX4_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=199 residues).
MATSLQDETLVVANDYMDFCIGIKRTPPSEFAKAMRYMAKKVENKHRSSLHQLVETFCRYGGFNTWTKLKNFMLDVFGGE
STSWGEILILFAFAGILAVQLSTTDEDVACSRRLAEMISDVLEEKQEWMIQNGGWMGFMDYVHTVKPGYSESPLKKALPA
AATVAIASLLTGYLLKRTLPDLLPSSFSILKKLPGTSVC
>gnl|bcl2dbpro|A0A3B3TFS5_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=176 residues).
MSSSLQNETLMVADDYMKFCIGISSTPPSESAKAMRCLAKEVESSQGPTLRALVQTFLIACGADPWTGLRSVMLELVGDG
RLNWGRVISLFAFTGMLASELCSRGEDVSCSRRLAEMMVDFLNGEKQEWLIQNGGWGGFTNFVHTARPADQDSSMRKALY
AAAGVGIAGITFLLVR
>gnl|bcl2dbpro|A0A669PBN3_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Phasianus colchicus (length=177 residues).
MPGSLKEETALLLEDYFQHRAGGAALPPSATAAELRRAAAELERRERPFFRSCAPLARAEPREAAALLRRVAAQLEADGG
LNWGRLLALVVFAGTLAAALAKSGCEEGPGRLAAALAAYLAEEQGEWLREHGGWDGFCRFFGRHGSQPADQNSTLSNAIM
AAAGFGIAGLAFLLVVR
>gnl|bcl2dbpro|A0A670ZE69_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Pseudonaja textilis (length=160 residues).
RDGSGTQLPGAGPGRARRTMPGALREETAQLLGDYVQHRLGGAAPLPPPSRTAETLRRVADELESRERLFFRNACSAAAL
PEPGEAAVVLLGRVATQMEAEGGLNWGRVVALVVFAGNLAAALAERGGPDHSGALVEALAAYLAEERRDWLEAHGGWVSA
>gnl|bcl2dbpro|A0A3B4EE08_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Pygocentrus nattereri (length=176 residues).
MSCWLRKETLVLAEDYIDFCTGIQRTPPSESAEAMRHLAKEMERQNHVKFLSMTQGFLSACGSDPSAYLHRVMTVLVEDG
QMNWGRVVSLFTFTGVLATELFSRGEGPEVCRTLAETIADYLGGEKKDWLEENEGWEGFCKFVRRAGHVTQDSSMKTALF
AAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|U5NM37_uncORF16-01 Putative ORF16 protein OS=[Viruses] Retroperitoneal fibromatosis-associated herpesvirus (length=178 residues).
MQSRQLPPDVAAIEGILLVCGLDRPEYVHHPVLSPIRTCVSYIVRTRAEDFNQMLDDARIESVAGLARLGRGMLHMNREG
GMNWGRALALLALGCTAIRRLSPNRHLTAFAMGMFPLYMYQAIGPQWFRAHGGWSGFKIYCERYTQEQETLRLLLVFAAV
GLVAAVSACWVAYRRGSW
>gnl|bcl2dbpro|Q77NK4_uncORF16-01 Putative ORF16 protein OS=[Viruses] Rhesus monkey rhadinovirus H26-95 (length=187 residues).
MAAVQGPPPPPEEENENSLPVDVYAIEGIFLYCGLGQAEYLHHPVFSPIKEFISAFLKDSARLYERLLRHTDYRSLRGLN
AIGQGMLQINTDGRHNWGRALAVLGLGAYVVDKVKDDERLLTFAIAVLPVYAYEALESQWFRSHGEWEGLRNYCERILRH
RRNARRHMCYGVAAGLLALVALFAIRR
>gnl|bcl2dbpro|O40636_uncORF16-01 Putative ORF16 protein OS=[Viruses] Saimiriine herpesvirus 2 (length=160 residues).
MSSIRFQNIVENILNKCQDNKHSQDSVVRAIHSVIHQYNKFEALMPDFSLCVHDRLKFTGEAILLTTEHTTNWGKVVAML
SFSAAVLQTIDEEYKCVATSMLSSYIARSVGANWFMENGGEKSLVKFCNSIMPKNPFNVLNFLVPAVLAGFVLIQTLLIK
>gnl|bcl2dbpro|Q01001_uncORF16-01 Putative ORF16 protein OS=[Viruses] Saimiriine herpesvirus 2 (length=160 residues).
MSSIKFQNIIENILKKCQDNRHSQDSVVRAVHSVIHQYNKFEALMPDFSLCVHDRIKFTGEAILLTTEHTTNWGKVVAML
SFSAAVLQTIDEEYKCVATSMLSSYISRSVGANWFIENGGEKSLVEFCNSIMPQNPFNVLNFLVPAVLAGLVLMQTLLIK
>gnl|bcl2dbpro|A0A671R5G8_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Sinocyclocheilus anshuiensis (length=176 residues).
MSCWLREQTLLLAEDYISFCSGIQQTPPSESAEAMRYLANEMEQQHRTKFRSLSQEFLDTCGSDPSKCLQRVMRELVGDG
KLNWGRVVSIFTFTGVLARELLSKGENSDCSRRLAETIADYLGGEKQDWLMENGGWEGFCRFFHNARQLNQESSMKTALF
AAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A671SIZ0_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Sinocyclocheilus anshuiensis (length=198 residues).
MTSDCCLRNCRWRAQSDIAGRKMSCWLREQTLLLAEDYISFCSGIQQTPPSESAEAMRYLAKEMEQQHRTKFRSLSQEFL
DTCGSDPSKCLQSVMRELVGDGKLNWGRVVSIFTFTGVLASELLSRGENSKCSRRLAETIADYLGGEKQDWLVENGGWEG
FCRFFHTARQLNQESSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A672MV21_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Sinocyclocheilus grahami (length=176 residues).
MSCWLREQTLLLAEDYISFCSGIQQTPPSESAEAMRYLAKEMEQQHRTKFRSLSQEFLDTCGSDPSKCLQSVMRELVGDG
KLNWGRVVSIFTFTGVLASELLSRGENSKCSRRLAETIADYLGGEKQDWLVENGGWEGFCRFFHTARQLNQESSMKTALF
AAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A673L8R2_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous (length=176 residues).
MSCWLREQTLLLAEDYISFCSGIQQTPPSESAEAMRYLAKEMEQQHRTKFRSLSQEFLDTCGSDPSKCLQSVMRELVGDG
KLNWGRVVSIFTFTGVLASELLSRGENSKCSRRLAETIADYLGGEKQDWLVENGGWEGFCRFFHTARQLNQESSMKTALF
AAAGVGLAGLTFLLVR
© 1998-2021Legal notice