Dataset for protein herpesviridae of organism Varanus komodoensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8D2LWG1_vNR13-01 vNR13 protein OS=[Eukaryota] Varanus komodoensis GN=vNR13 (length=178 residues).
MPGALREETAQLLADYFQHRLGAAALPPSRTAETLRRVADELESRERPFFRDACGAAAAAEPGEAAALLGRVAAQMEAEG
GLNWGRVVALVVFAGNLAAALAERGARDETGALVEALAAYLAGEKREWLEAHGGWDGFYHFFNKHDSDAADQSSTISNAI
MAAAGFGLAGLAFLLAVR
© 1998-2022Legal notice