Dataset for protein herpesviridae of organism Terrapene carolina triunguis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A674KEW6_vNR13-01 vNR13 protein OS=[Eukaryota] Terrapene carolina triunguis GN=vNR13 (length=178 residues).
MPGSLKEQTALLLGDYFQHRLGGPALPPPSPAAETLRRAASELESRERPFFRACRPLALDERREPAALLSRVAEQLEAEG
GLNWGRVLALVVFAGSLAAALAEQGSREEAGRLAEVLASYLAEEKREWLEAHGGWDGFCHFFNGHGSQPTDQNSTISSAI
MAAAGFGLAGLAVLLAVR
© 1998-2020Legal notice