Dataset for protein herpesviridae of organism Taeniopygia guttata

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A674GY73_vNR13-01 vNR13 protein OS=[Eukaryota] Taeniopygia guttata GN=vNR13 (length=177 residues).
MPRSLKEETALLLEDYFQHRSGSAALPPSPTAAVLRRAAAELERQERPFFRSCAPLARAEPREAAALLGRVAAQLEADGG
LNWGRLLALVVFAGTLAAALAERGCSDGPRCLAAHLAAYLAEERGEWLEAHGGWDGFCRFFGRHGSEAAEQSSTIGNAIM
AAAAGIGMAGLAFLLVR
© 1998-2020Legal notice