Dataset for protein vNR13 of organism Strigops habroptila

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A672TYX3_vNR13-01 vNR13 protein OS=[Eukaryota] Strigops habroptila GN=vNR13 (length=177 residues).
MPSSLKEETALLLEDYFQHRRGGSALPPSPTAATLRRAAAELERQERVFFRSCAPLARAEPQEATALLGRVAVQLEADGG
LNWGRLLALVVFAGTLAAALDERGCADGPRCLAAALAAYLAEERGEWLEAHGGWDGFCRFFSRQGSETAEQSSTISNAIM
AAAGFGIAGLAFLLVVR
© 1998-2020Legal notice