Dataset for protein herpesviridae of organism Sphenodon punctatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8D0L3Y5_vNR13-01 vNR13 protein OS=[Eukaryota] Sphenodon punctatus GN=vNR13 (length=178 residues).
MPGALEEETALLLADYFQHRLGGAALPPSPTAQTLRRVAGELESRERPFFRSACRPLALAEPGEPAALLARVAAELEAEG
GLNWGRVLALVVFAGSLAEALVERGAREETGRLAEVLSTYLAGEKREWLEANGGWDGFYHFFNKHGSQPTDQNSTISNAI
MAAAGFGLAGLAFLLAVR
© 1998-2022Legal notice