Dataset for protein Unclassified of organism Sinocyclocheilus rhinocerous

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A673L8R2_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous (length=176 residues).
MSCWLREQTLLLAEDYISFCSGIQQTPPSESAEAMRYLAKEMEQQHRTKFRSLSQEFLDTCGSDPSKCLQSVMRELVGDG
KLNWGRVVSIFTFTGVLASELLSRGENSKCSRRLAETIADYLGGEKQDWLVENGGWEGFCRFFHTARQLNQESSMKTALF
AAAGVGLAGLTFLLVR
© 1998-2020Legal notice