Dataset for protein Unclassified of organism Sinocyclocheilus anshuiensis

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A671R5G8_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Sinocyclocheilus anshuiensis (length=176 residues).
MSCWLREQTLLLAEDYISFCSGIQQTPPSESAEAMRYLANEMEQQHRTKFRSLSQEFLDTCGSDPSKCLQRVMRELVGDG
KLNWGRVVSIFTFTGVLARELLSKGENSDCSRRLAETIADYLGGEKQDWLMENGGWEGFCRFFHNARQLNQESSMKTALF
AAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A671SIZ0_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Sinocyclocheilus anshuiensis (length=198 residues).
MTSDCCLRNCRWRAQSDIAGRKMSCWLREQTLLLAEDYISFCSGIQQTPPSESAEAMRYLAKEMEQQHRTKFRSLSQEFL
DTCGSDPSKCLQSVMRELVGDGKLNWGRVVSIFTFTGVLASELLSRGENSKCSRRLAETIADYLGGEKQDWLVENGGWEG
FCRFFHTARQLNQESSMKTALFAAAGVGLAGLTFLLVR
© 1998-2020Legal notice