Dataset for protein Unclassified of organism Serinus canaria

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C9MNY5_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Serinus canaria (length=105 residues).
MEADGGLNWGRLLALVVFAGTLAAALAERGCSDGPRCLAAHLAAYLAEERGEWLEEHGGWDGFCRFFGRPGSEGAEQSST
IGNAMVAAAAAAGIGVAGLAFLLVR
© 1998-2022Legal notice