Dataset for protein Unclassified of organism Scleropages formosus

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C9T0J9_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Scleropages formosus (length=189 residues).
MSSPLERETLLVAKDYVGFCTGIRQDPPSESAKAMRQLAKQTERQHRSTFQTLVQNFLDNSEPDFLTSLKQTMAALAHDG
QLNWGRVVALFAFAGMLASELSSRGVDVSNRRLAETIARYLSEEHGEWLLHNGGWVGFLSFFHMGRGADLGLFLRNAFFA
VSVASIAGIAALLRPGRLPLGSLLRLFFA
>gnl|bcl2dbpro|A0A8C9TV46_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Scleropages formosus (length=233 residues).
MSSPLERETLLVAKDYVGFCTGIRQDPPSESAKAMRQLAKQTERQHRSTFQTLVQNFLDNSEPDFLTSLKQTMAALAHDG
QLNWGRVVALFAFAGMLASELSSRGVDVSNRRLAETIARYLSEEHGEWLLHNGGWAKNSQSKDPRGSLLGRRRAAIPAML
TTETAKKAFCRNDPKSTPLTMRKKERKPTYTRDKQNAKAQNRLEHIYTLFQHLIASAALFPLHIGTWKTILFT
© 1998-2022Legal notice