Dataset for protein herpesviridae of organism Salvator merianae

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8D0KNJ6_vNR13-01 vNR13 protein OS=[Eukaryota] Salvator merianae GN=vNR13 (length=184 residues).
MPGALREETVRLLGDYLQHRLGRGAAPPPSRPAETLRRVADELESRERPFFRSACSSAGALPEEPGEAAALLSRVAAQME
AEGGLNWGRVVALVVFAGNLAAALAERGARGDEETPGALAEALAAYLAGEKREWLEAHGGWDGFYHFFNKHGSDAAEQNS
AISNAIMAAAGFGLAGLAFLLAVR
© 1998-2022Legal notice