Dataset for protein Unclassified of organism Pseudonaja textilis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A670ZE69_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Pseudonaja textilis (length=160 residues).
RDGSGTQLPGAGPGRARRTMPGALREETAQLLGDYVQHRLGGAAPLPPPSRTAETLRRVADELESRERLFFRNACSAAAL
PEPGEAAVVLLGRVATQMEAEGGLNWGRVVALVVFAGNLAAALAERGGPDHSGALVEALAAYLAEERRDWLEAHGGWVSA
© 1998-2020Legal notice