Dataset for protein vNR13 of organism Podarcis muralis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A670KGT8_vNR13-01 vNR13 protein OS=[Eukaryota] Podarcis muralis GN=vNR13 (length=183 residues).
MPGALREETVQLMADYLQHRLGGGGGAAALPPSRTAETLRRVADELESRERPFFRSACTAAALPQEPGEAAALLGRVAAQ
MEAEGGLNWGRVVALVVFAGNLAAALAERGARDQTAALAEALAAYLAGEKREWLEAHGGWDGFYHFFNKHGSDAADQNST
ISNAIMAAAGFGLAGLAFLLAVR
© 1998-2020Legal notice