Dataset for protein Unclassified of organism Phasianus colchicus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A669PBN3_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Phasianus colchicus (length=177 residues).
MPGSLKEETALLLEDYFQHRAGGAALPPSATAAELRRAAAELERRERPFFRSCAPLARAEPREAAALLRRVAAQLEADGG
LNWGRLLALVVFAGTLAAALAKSGCEEGPGRLAAALAAYLAEEQGEWLREHGGWDGFCRFFGRHGSQPADQNSTLSNAIM
AAAGFGIAGLAFLLVVR
© 1998-2020Legal notice