Dataset for protein herpesviridae of organism Pelusios castaneus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C8VNX1_vNR13-01 vNR13 protein OS=[Eukaryota] Pelusios castaneus GN=vNR13 (length=177 residues).
MPGSLKEQTALLLADYFQHRLGGAAAAPSPAAETLRRAASELESRERPFFRACRPLALDERREPAALLARVAEQLEAEGG
LNWGRVLALVVFAGSLAAALAEHGSREEAGRLAEVLAAYLAEEKREWLEAHGGWDGFCHFFNGHGSQPSDQHSTISSAIM
AAAGFGLAGLAFLLAVR
© 1998-2022Legal notice