Dataset for protein Unclassified of organism Otarine gammaherpesvirus 4

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A889IVX4_uncBALF1-01 Putative BALF1 protein OS=[Viruses] Otarine gammaherpesvirus 4 (length=421 residues).
MASASELEALKVCCANSSLLNHNSEDNESCSEDSCSSDHGEYYCYSDYGSETNLHYRSHSSECRFDDADGIEQGTTDNNQ
KTTIENCGTYNSDASTSTYNNGYLEKQAANTVNVGSKLQQVNVPISGGESLPANNTSAEHRLYANCHEYMELTSPMKSKG
TQTPLQYAPNPQSVEELASSVSKTTMKQPALIQVPSDQPPPIPPKLHNNPCHNSFQRFYPVVRSTDGRCSEPTYANAHIV
PDMSFGTNTAKTCTIDLVSAKCIFKELADTTQVVYNVLTAVMLPNESTQHLSASEHTLAWVVTQCIKEEWPRLTGMVFDL
PPPENADHYNHVMRVVEVAHADDSGSWGRLCITLAFICVYAKCYMNNSREIRDRFANLLSDYYALNRMSWLINMGGITKG
VRGRFPLFWMWYKLKEVFSSF
© 1998-2022Legal notice