Dataset for protein Unclassified of organism Ornithorhynchus anatinus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A6I8NZN5_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Ornithorhynchus anatinus (length=199 residues).
MAGSLREQTALLVADYLAQCGPGPAPPAPPPSPAAATLRRAAAALRRQHRPFFVCARRRAGAGAGPGDRPGDGDGAGDGD
GDGAGPAALLAQVAAELDHDGGLNWGRVVALVALAGALLDPEPDPRTPDLSRTLADTLCHYLAEEKGDWLREHGGWDGFY
HFFNQPEGRPAEQNSAFCNAIMAAAGFGLAGLAFLLAVR
© 1998-2020Legal notice