Dataset for protein vNR13 of organism Nothoprocta perdicaria

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C7EHJ2_vNR13-01 vNR13 protein OS=[Eukaryota] Nothoprocta perdicaria GN=vNR13 (length=176 residues).
MPGSLKEETALLLQDYFEHRRGGAALPPSATAATLRRAAGELERRERPFFRSCAALARAEPWEAAALLARVAAQLEAEGG
LNWGRLLALVVFAGALAAAMAERGCADGPRRLAAALTDYLAEEKGAWLEAHGGWDGFHHFFRQDSQPAEQSNTISNAIMA
AAGFGIAGLAFLLVVR
© 1998-2022Legal notice