Dataset for protein vNR13 of organism Naja naja

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C6YHI4_vNR13-01 vNR13 protein OS=[Eukaryota] Naja naja GN=vNR13 (length=179 residues).
MPGALREETAQLLGDYVQHRLGGAALPPPSRTAETLRRVADELESRERLFFRNACSAAALPEPGEAAALLGRVATQMEAE
GGLNWGRVVALVVFAGNLAAALAERGAPDHSGALVEALAAYLAEERRDWLEAHGGWDGFYHFFNKHGSDAADQNSTISNA
IMAAAGFGLAGLAFLLVVR
© 1998-2022Legal notice