Dataset for protein M11 of organism Murine herpesvirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A6M4EIA3_M11-01 M11 protein OS=[Viruses] Murine herpesvirus GN=M11 (length=171 residues).
MSHKKSGTYWATLITAFLKTVSKVEELDCVDSAVLVDVSKIITLTQEFRRHYDSVYRADYGPALKNWKRDLSKLFTSLFV
DVINSGRIVGFFDVGRYVCEEVLCPGSWTEDHELLNDCMTHFFIENNLMNHFPLEDIFLAQRKFQTTGFTFLLHALAKVL
PRIYSGNVIYV
© 1998-2021Legal notice