Dataset for protein herpesviridae of organism Meleagrid herpesvirus 1

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q9DH00_vNR13-01 vNR13 protein OS=[Viruses] Meleagrid herpesvirus 1 GN=vNR13 (length=162 residues).
MADSLKEETALLLEDYFQHCCGKEGPPPSPTAAELRRAAAELERRERPFFRSCAPLASGGTQAALSALQSVVSELNSGSG
FNWGRCLATIVLGGSLATALYENGCEEGPSRLAAALAAYLAEEQGEWLREHGGWVSTARAGMSGSFGSPVSARSEEHRAR
RW
© 1998-2020Legal notice