Dataset for protein Unclassified of organism Malurus cyaneus samueli

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C5T5F9_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Malurus cyaneus samueli (length=165 residues).
HADYFQHRSGGAALPFSPTAAVLRRAAAELERQERPFFRSCAPLARAEPREAAALLGRVAAQLEADGGLNWGRLLALVVF
AGTLAAALAEQGCSDGPRCLAEHLAAYLAEERGEWLEAHGGWDGFCHFFGRHGSEAAEQSSTIGNAIMAAAAGIGMAGLA
FLLVR
© 1998-2022Legal notice