Dataset for protein herpesviridae of organism Macacine gammaherpesvirus 4

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q8UZJ4_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Macacine gammaherpesvirus 4 GN=BHRF1 (length=191 residues).
MAFSTRDLLLALCMRDSHVHGNEGLHPVLELASRESPSSLSAGDTLVLRVHVLLEQIIEQNAGAFLEALDRFLSNTEEWD
VDFTRVFQEIFHRGNPTLGRALAWLAWCMHACRTLCCNRNTPYYVVDLSVRGMLEASEGLDAWIHQQGGWPSLLRGNRSN
TGSPILTAFLAGLTLTFVVVCSYLFISGRRR
© 1998-2020Legal notice