Dataset for protein Unclassified of organism Leptobrachium leishanense

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C5N071_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Leptobrachium leishanense (length=178 residues).
MSRRLREESARLLEEYLQHSLDAGGERRAEPSTPAGRTLRIIAGEMLDRNRTFYEQCCQQLSGRPADILRCVAAKVMEDG
ALNWGRVVSIITFTGTLAQWAKANGTGTPKELAEVLSHFLAEEHGDWMESNGGWNGFHEHFCNNKAAHPARENNAVSGAL
MAVAGVGLAGLAFLLAVR
© 1998-2022Legal notice