Dataset for protein vNR13 of organism Gopherus evgoodei

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C4VQB8_vNR13-01 vNR13 protein OS=[Eukaryota] Gopherus evgoodei GN=vNR13 (length=178 residues).
MPGSLKEQTALLLGDYFQHRLGDAALPPPSPAAETLRRVASELESRERPFFRACRPLALDERREPAALLSRVAEQLEAEG
GLNWGRVLALVVFAGSLAAALAEQGSREEAGRLAEVLASYLAEEKREWLEAHGGWDGFCHFFNGHGSQPTDQSSTISSAI
MAAAGFGLAGLAVLLAVR
© 1998-2022Legal notice