Dataset for protein vNR13 of organism Falco tinnunculus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C4V604_vNR13-01 vNR13 protein OS=[Eukaryota] Falco tinnunculus GN=vNR13 (length=177 residues).
MPGSLKEETALLLEDYFQHRGGGAALPPSPTAATLRRAAAELERRERPFFRSCAPLARAEPREAAALLARVAAQLEADGG
LSWGRLLALVVFAGTLAAALAERGCGDGPRCLAAALAAYLAEERGEWLEAHGGWDGFCRFFGRHGSQPADQSSTISNAIM
AAAGFGIAGLAFLLVVR
© 1998-2023Legal notice