Dataset for protein Unclassified of organism Electrophorus electricus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A4W4ETM5_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Electrophorus electricus (length=176 residues).
MSCWLRKETLVLAEDYIDFCTGIRRTPPSESAEAMRCLAKEMERQHLSKFRSLSQRLLGACGSDPSTCLRSVMAELVNDG
KLNWGRVVSLFTFTGVLATELFSRGEGPECCRSLAETIADYLGGEKRDWLEENEGWEGFCRFFRGMGHVGQESSMKTALF
AAAGVGLAGLTFLLVR
© 1998-2020Legal notice