Dataset for protein Unclassified of organism Denticeps clupeoides

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C4C6C1_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Denticeps clupeoides (length=174 residues).
MSCWSETMALAKDYIDFCSGTQRTPPSESAAAMRHLAKELEQQHWSKFQALSQTFLGSCGADPSHSLRRVMEELVGDGKM
NWGRVVSLFTFTGVLAAELFSRGKDRDFCQSLAKTVADYLGEEKSDWLMENEGWEGFCKFSRAAREVNQESSMKTALFAA
AGVGIAGLTFLLVR
© 1998-2022Legal notice