Dataset for protein Unclassified of organism Cyprinus carpio

[Download (right click)]

16 sequence(s)

>gnl|bcl2dbpro|A0A8C1JZB8_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Cyprinus carpio (length=260 residues).
MRSDCCLRNCRWRAQSDIAGRKMSCWLREQTLLLAEDYIGFCSGIQQTPPSESAEAMRYLAKEMEQQYRTKFRSLSQEFL
DTCGSDPSKCLQSVMRELVGDGKLNWGRVVSIFTFTGVLASELLSRGENSECSRRLAETIADYLGGEKQDWLVENGGWEG
FCRFFHNARQLNQESSMKTALFAAAGVGLAGYFHDGPLMLRDEPVGGDENHWRNLSMTDGHFRQRDLICLILTIQMVCRP
TTLQHTLFPTFVPLFLSFSA
>gnl|bcl2dbpro|A0A8C1JZB8_uncvNR13-05 Putative vNR13 protein OS=[Eukaryota] Cyprinus carpio (length=371 residues).
CILSYLLTYLSSICVFLKMACQGLAKGETIHTLKAESETLKTKLEEERAKLHDVELHQVAEKIEALGQFVMKTRRTLKGH
GNKVLCVDWCRDKRRIVSSSQDGKVIVWDAYTTNKEHAVTMPCTWVMACAYAPSGCAVACGGLDNKCSVYPLSLDKNENL
AAKKKSVAMHTNYLSSCSFTNSDMQILTSSGDGTCALWDVESGQLLQSFHGHSADVLSLNLAPSETGNTFVSGGCDKKAN
VWDMRSGQNVQSFETHESDINSVKYYPSGDAFATGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGY
NDYTINVWDVLKGTRVAILFGHENRVSTVRVSPDGTAFCSGSWDNTLRIWA
>gnl|bcl2dbpro|A0A8C1JZB8_uncvNR13-02 Putative vNR13 protein OS=[Eukaryota] Cyprinus carpio (length=569 residues).
MCDQTFLAITFGPCDNCSQNKPLMNIYLKNEPINYCSLCVELMACQGLAKGETIHTLKAESETLKTKLEEERAKLHDVEL
HQVAEKIEALGQFVMKTRRTLKGHGNKVLCVDWCRDKRRIVSSSQDGKVIVWDAYTTNKEHAVTMPCTWVMACAYAPSGC
AVACGGLDNKCSVYPLSLDKNENLAAKKKSVAMHTNYLSSCSFTNSDMQILTSSGDGTCALWDVESGQLLQSFHGHSADV
LSLNLAPSETGNTFVSGGCDKKANVWDMRSGQNVQSFETHESDINSVKYYPSGDAFATGSDDATCRLYDLRADREVAIYS
KESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGTRVAILFGHENRVSTVRVSPDGTAFCSGSWDNTLRKMSCWLRE
QTLLLAEDYIGFCSGIQQTPPSESAEAMRYLAKEMEQQYRTKFRSLSQEFLDTCGSDPSKCLQSVMRELVGDGKLNWGRV
VSIFTFTGVLASELLSRGENSECSRRLAETIADYLGGEKQDWLVENGGWEGFCRFFHNARQLNQESSMKTALFAAAGVGL
AGLTFLLVR
>gnl|bcl2dbpro|A0A8C1JZB8_uncvNR13-03 Putative vNR13 protein OS=[Eukaryota] Cyprinus carpio (length=178 residues).
MKMSCWLREQTLLLAEDYIGFCSGIQQTPPSESAEAMRYLAKEMEQQYRTKFRSLSQEFLDTCGSDPSKCLQSVMRELVG
DGKLNWGRVVSIFTFTGVLASELLSRGENSECSRRLAETIADYLGGEKQDWLVENGGWEGFCRFFHNARQLNQESSMKTA
LFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A8C1JZB8_uncvNR13-06 Putative vNR13 protein OS=[Eukaryota] Cyprinus carpio (length=332 residues).
MLFQTHKNILDENREALHQVAEKIEALGQFVMKTRRTLKGHGNKVLCVDWCRDKRRIVSSSQDGKVIVWDAYTTNKEHAV
TMPCTWVMACAYAPSGCAVACGGLDNKCSVYPLSLDKNENLAAKKKSVAMHTNYLSSCSFTNSDMQILTSSGDGTCALWD
VESGQLLQSFHGHSADVLSLNLAPSETGNTFVSGGCDKKANVWDMRSGQNVQSFETHESDINSVKYYPSGDAFATGSDDA
TCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGTRVAILFGHENRVSTVRVSPDGTAFC
SGSWDNTLRIWA
>gnl|bcl2dbpro|A0A8C1JZB8_uncvNR13-04 Putative vNR13 protein OS=[Eukaryota] Cyprinus carpio (length=395 residues).
MCDQTFLAITFGPCDNCSQNKPLMNIYLKNEPINYCSLCVELMACQGLAKGETIHTLKAESETLKTKLEEERAKLHDVEL
HQVAEKIEALGQFVMKTRRTLKGHGNKVLCVDWCRDKRRIVSSSQDGKVIVWDAYTTNKEHAVTMPCTWVMACAYAPSGC
AVACGGLDNKCSVYPLSLDKNENLAAKKKSVAMHTNYLSSCSFTNSDMQILTSSGDGTCALWDVESGQLLQSFHGHSADV
LSLNLAPSETGNTFVSGGCDKKANVWDMRSGQNVQSFETHESDINSVKYYPSGDAFATGSDDATCRLYDLRADREVAIYS
KESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGTRVAILFGHENRVSTVRVSPDGTAFCSGSWDNTLRIWA
>gnl|bcl2dbpro|A0A8C1MTT1_uncvNR13-02 Putative vNR13 protein OS=[Eukaryota] Cyprinus carpio (length=223 residues).
MRFDCCLRNCRWRAQSDIAGRKMSCWLREQTLLLAEDYISFCSGIQQTPPSESAEAMRYLAKEMEQQYRTKFRSLTQEFL
DTCGSDPCKCLQSVMREMVGDGKLNWGRVVSIFTFTGVLASELLSREENSDCSRRLAETIADYLGGEKQDWLVENGGWEG
FCRFFHKAKQLNQESSMKTALFAAAGVGLAGLTFLLQTVIHVDCTLFTWPSGEKNGISNSLHI
>gnl|bcl2dbpro|A0A8C1MTT1_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Cyprinus carpio (length=198 residues).
MRFDCCLRNCRWRAQSDIAGRKMSCWLREQTLLLAEDYISFCSGIQQTPPSESAEAMRYLAKEMEQQYRTKFRSLTQEFL
DTCGSDPCKCLQSVMREMVGDGKLNWGRVVSIFTFTGVLASELLSREENSDCSRRLAETIADYLGGEKQDWLVENGGWEG
FCRFFHKAKQLNQESSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A8C1VD76_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Cyprinus carpio (length=198 residues).
MRFDCCLRNCRWRAQSDIAGRKMSCWLREQTLLLAEDYIGFCSGIQQTPPSESAEAMRYLAKEMEQQYRTKFRSLSQEFL
DTCGSDPSKCLQSVMRELVGDGKLNWGRVVSIFTFTGVLASELLSREENSDCSRRLAETIADYLGGEKQDWLVENGGWEG
FCRFFHKAKQLNQESSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A8C1VD76_uncvNR13-02 Putative vNR13 protein OS=[Eukaryota] Cyprinus carpio (length=223 residues).
MRFDCCLRNCRWRAQSDIAGRKMSCWLREQTLLLAEDYIGFCSGIQQTPPSESAEAMRYLAKEMEQQYRTKFRSLSQEFL
DTCGSDPSKCLQSVMRELVGDGKLNWGRVVSIFTFTGVLASELLSREENSDCSRRLAETIADYLGGEKQDWLVENGGWEG
FCRFFHKAKQLNQESSMKTALFAAAGVGLAGLTFLLQTVIHVDCTLFTWPSGEKDGSSNSLHI
>gnl|bcl2dbpro|A0A8C2FVR0_uncvNR13-06 Putative vNR13 protein OS=[Eukaryota] Cyprinus carpio (length=198 residues).
MRSDCCLPNCRWRAQSDIAGRKMSCWLREQTLLLAEDYIGFCSGIQQTPPSESAEAMRYLAKEMEQQYRTKFRSLSQEFL
DTCGSDPSKCLQSVMRELVGDGKLNWGRVVSIFTFTGVLASELLSRGENSECSRRLAETIADYLGGEKQDWLVENGGWEG
FCRFFHNARQLNQESSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A8C2FVR0_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Cyprinus carpio (length=569 residues).
MCDQTFLAITFGPCDNCSQNKPLMNIYLKNEPINYCSLCVELMACQGLAKGETIHTLKAESETLKTKLEEERAKLHDVEL
HQVAEKIEALGQFVMKTRRTLKGHGNKVLCVDWCRDKRRIVSSSQDGKVIVWDAYTTNKEHAVTMPCTWVMACAYAPSGC
AVACGGLDNKCSVYPLSLDKNENLAAKKKSVAMHTNYLSSCSFTNSDMQILTSSGDGTCALWDVESGQLLQSFHGHSADV
LSLNLSPSETGNTFVSGGCDKKANVWDMRSGQNVQSFETHESDINSVKYYPSGDAFATGSDDATCRLYDLRADREVAIYS
KESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGTRVAILFGHENLVSTVRVSPDGTAFCSGSWDNTLRKMSCWLRE
QTLLLAEDYIGFCSGIQQTPPSESAEAMRYLAKEMEQQYRTKFRSLSQEFLDTCGSDPSKCLQSVMRELVGDGKLNWGRV
VSIFTFTGVLASELLSRGENSECSRRLAETIADYLGGEKQDWLVENGGWEGFCRFFHNARQLNQESSMKTALFAAAGVGL
AGLTFLLVR
>gnl|bcl2dbpro|A0A8C2FVR0_uncvNR13-02 Putative vNR13 protein OS=[Eukaryota] Cyprinus carpio (length=433 residues).
MCDQTFLAITFGPCDNCSQNKPLMNIYLKNEPINYCSLCVELMACQGLAKGETIHTLKAESETLKTKLEEERAKLHDVEL
HQVAEKIEALGQFVMKTRRTLKGHGNKVLCVDWCRDKRRIVSSSQDGKVIVWDAYTTNKEHAVTMPCTWVMACAYAPSGC
AVACGGLDNKCSVYPLSLDKNENLAAKKKSVAMHTNYLSSCSFTNSDMQILTSSGDGTCALWDVESGQLLQSFHGHSADV
LSLNLSPSETGNTFVSGGCDKKANVWDMRSGQNVQSFETHESDINSVKYYPSGDAFATGSDDATCRLYDLRADREVAIYS
KESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGTRVAILFGHENLVSTVRVSPDGTAFCSGSWDNTLRVSVCFRFS
GESDLRNILYGFALYWHQGLYIGVLHHPVMSVP
>gnl|bcl2dbpro|A0A8C2FVR0_uncvNR13-03 Putative vNR13 protein OS=[Eukaryota] Cyprinus carpio (length=395 residues).
MCDQTFLAITFGPCDNCSQNKPLMNIYLKNEPINYCSLCVELMACQGLAKGETIHTLKAESETLKTKLEEERAKLHDVEL
HQVAEKIEALGQFVMKTRRTLKGHGNKVLCVDWCRDKRRIVSSSQDGKVIVWDAYTTNKEHAVTMPCTWVMACAYAPSGC
AVACGGLDNKCSVYPLSLDKNENLAAKKKSVAMHTNYLSSCSFTNSDMQILTSSGDGTCALWDVESGQLLQSFHGHSADV
LSLNLSPSETGNTFVSGGCDKKANVWDMRSGQNVQSFETHESDINSVKYYPSGDAFATGSDDATCRLYDLRADREVAIYS
KESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGTRVAILFGHENLVSTVRVSPDGTAFCSGSWDNTLRIWA
>gnl|bcl2dbpro|A0A8C2FVR0_uncvNR13-04 Putative vNR13 protein OS=[Eukaryota] Cyprinus carpio (length=370 residues).
ILSYLLTYPSSICVFLKMACQGLAKGETIHTLKAESETLKTKLEEERAKLHDVELHQVAEKIEALGQFVMKTRRTLKGHG
NKVLCVDWCRDKRRIVSSSQDGKVIVWDAYTTNKEHAVTMPCTWVMACAYAPSGCAVACGGLDNKCSVYPLSLDKNENLA
AKKKSVAMHTNYLSSCSFTNSDMQILTSSGDGTCALWDVESGQLLQSFHGHSADVLSLNLSPSETGNTFVSGGCDKKANV
WDMRSGQNVQSFETHESDINSVKYYPSGDAFATGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYN
DYTINVWDVLKGTRVAILFGHENLVSTVRVSPDGTAFCSGSWDNTLRIWA
>gnl|bcl2dbpro|A0A8C2FVR0_uncvNR13-05 Putative vNR13 protein OS=[Eukaryota] Cyprinus carpio (length=338 residues).
MSHHFHLFFQIFFNTRHTKWNNVHQVAEKIEALGQFVMKTRRTLKGHGNKVLCVDWCRDKRRIVSSSQDGKVIVWDAYTT
NKEHAVTMPCTWVMACAYAPSGCAVACGGLDNKCSVYPLSLDKNENLAAKKKSVAMHTNYLSSCSFTNSDMQILTSSGDG
TCALWDVESGQLLQSFHGHSADVLSLNLSPSETGNTFVSGGCDKKANVWDMRSGQNVQSFETHESDINSVKYYPSGDAFA
TGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGTRVAILFGHENLVSTVRVSP
DGTAFCSGSWDNTLRIWA
© 1998-2022Legal notice