Dataset for protein Unclassified of organism Cyanoderma ruficeps

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C3QI35_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Cyanoderma ruficeps (length=179 residues).
MPRSLKEETALLLEDYFQHRGGGAALPPSPTAAALRRAAAELERQERPFFHSCAPLARAEPREAAALLGKVAAQLEADGG
LNWGRLLALVVFAGTLAAALAERGCGDGPRCLAAHLATYLAEERGEWLEAHGGWDGFCRFFGRHGSEAAEQSSTIGNAIV
AAAAGIGIGMAGLAFLLVR
© 1998-2022Legal notice