Dataset for protein herpesviridae of organism Coturnix japonica

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C2U8D6_vNR13-01 vNR13 protein OS=[Eukaryota] Coturnix japonica GN=vNR13 (length=177 residues).
MPGSLKEETALLLEDYFQHRAGGAALPPSATAAELRRAAAELERRERPFFRSCAPLARAEPREAAALLRKVAAQLEADGG
LNWGRLLALVVFAGTLAAALTESGCEEGPSRLAAALTAYLAEEQGEWMEEHGGWDGFCRFFGRHGSQPADQNSTLSNAIM
AAAGFGIAGLAFLLVVR
>gnl|bcl2dbpro|Q90343_vNR13-01 vNR13 protein OS=[Eukaryota] Coturnix japonica GN=vNR13 (length=177 residues).
MPGSLKEETALLLEDYFQHRAGGAALPPSATAAELRRAAAELERRERPFFRSCAPLARAEPREAAALLRKVAAQLETDGG
LNWGRLLALVVFAGTLAAALAESACEEGPSRLAAALTAYLAEEQGEWMEEHGGWDGFCRFFGRHGSQPADQNSTLSNAIM
AAAGFGIAGLAFLLVVR
© 1998-2022Legal notice