Dataset for protein Unclassified of organism Colobine gammaherpesvirus 1

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A5B8FKL5_uncORF16-01 Putative ORF16 protein OS=[Viruses] Colobine gammaherpesvirus 1 (length=179 residues).
MDPDHPPPEVEDIRGILCVCGLEEPEYMEHPVISPIRVCVSSIMRRRARIFSQMINQFPILSTTGIERVGVGMLQMNADG
NMNWGRGLALLALACTVVRRVSGSRLLTEFALRVLPLYVYQAIGPNWFHAHGGWNGLRMYCRQFMEQQGNMRMFLLLTAA
GLVATVMALWLSSRQGPLG
© 1998-2020Legal notice