Dataset for protein vNR13 of organism Chrysemys picta bellii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C3IX63_vNR13-01 vNR13 protein OS=[Eukaryota] Chrysemys picta bellii GN=vNR13 (length=178 residues).
MPGSLKEQTALLLGDYFQHRLGGPALPPPSPAAETLRRAASELESRERPFFRACRPLALDERREPAALLSRVAEQLEAEG
GLNWGRVLALVVFAGSLAAALAEQGSREEAGRLAEVLASYLAEEKREWLEAHGGWDGFCHFFNGHGSQPTDQNSTISSAI
MAAAGFGLAGLAVLLAVR
© 1998-2022Legal notice