Dataset for protein vNR13 of organism Chloebia gouldiae

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3L8SM77_vNR13-01 vNR13 protein OS=[Eukaryota] Chloebia gouldiae GN=vNR13 (length=177 residues).
MPRSLKEETALLLEDYFQHRSGSAALPPSPTAAALRRAAAELERQERPFFRSCAPLARAEPREAAALLGRVAAQLEADGG
LNWGRLLALVVFAGTLAAALAERGCSDGPRCLAAHLAAYLAEERGEWLEAHGGWDGFCRFFGRHGSEAAEQSSTIGNAIM
AAAAGIGMAGLAFLLVR
© 1998-2020Legal notice