Dataset for protein herpesviridae of organism Chelydra serpentina

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C3SNB5_vNR13-01 vNR13 protein OS=[Eukaryota] Chelydra serpentina GN=vNR13 (length=178 residues).
MPGSLKEQTVLLLGDYFQHRLGGPALPPPSPAAETLRRAASELESRERPFFRACRPLALDERRDPAALLSRVAEQLEAEG
GLNWGRVLALVVFAGSLAAALAEQGSREEAGRLAEVLAAYLAEEKREWLEAHGGWDGFCHFFKGHGSQPNDQSSTISSAI
MAAAGFGLAGLAVLLAVR
© 1998-2022Legal notice