Dataset for protein Unclassified of organism Chelonoidis abingdonii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C0GYM6_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Chelonoidis abingdonii (length=101 residues).
AEGGLNWGRVLALVVFAGSLAAALAEQGSREEAGRLAEVLASYLAEEKREWLEAQGGWDGFCHFFNGHGSQPTDQSSTIS
SAIMAAAGFGLAGLAVLLAVR
© 1998-2022Legal notice