Dataset for protein Unclassified of organism Catharus ustulatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C3V615_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Catharus ustulatus (length=173 residues).
MPRSLKEETALLLEDYFQHRGGGAALPPSPTAAALRRAAAELERQERPFFRSCAPLARAEPREAAALLGRVAAQLEADGG
LNWGRLLALVVFAGTLAAALAERGCGDGPRCLAAHLAAYLAEERGDWLEAHGGWVSGDGRPGAALSKTSAIPQICSFPIP
SPSGILYVSTNKH
© 1998-2023Legal notice