Dataset for protein Unclassified of organism Callitrichine gammaherpesvirus 3

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q8BEN2_uncBHRF1-01 Putative BamHI-H right reading frame protein OS=[Viruses] Callitrichine gammaherpesvirus 3 (length=189 residues).
MPYSARHVLLELLRYFGSGDNALMTSLRNDRPQHPRIAVPRDILDTLIAAIQEICRDQESTLSASFQSLQNDADVENFIW
GVQEELFGDGCNWGRIVVWLAWCCFMCRCTRCCEDYNLVDAVFRGVLESTEGIDGWIHSHGGWDRFCDFLASRHVQQESE
HILIRLSVFMMLTTAVAVCAVFGYLCKLA
© 1998-2022Legal notice