Dataset for protein herpesviridae of organism Calidris pygmaea

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C3KMB5_vNR13-01 vNR13 protein OS=[Eukaryota] Calidris pygmaea GN=vNR13 (length=177 residues).
MPGSLKEETALLLEDYFQHRGGGSALPPSPTAAVLRRAAAELERRERPFFRSCAPLARAEPREAAALLRRVAAQLEADGG
LNWGRLLALVVFAGTLAAALAERGCGEGPRCLAAALAAYLAEERGEWLEAHGGWDGFCRFFGGHGSQTADQSSTISNAIM
AAAGFGIAGLAFLLVVR
© 1998-2022Legal notice