Dataset for protein Unclassified of organism Cairina moschata domestica

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C3BAQ2_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Cairina moschata domestica (length=177 residues).
MPGSLKEETALLLQDYFQHRGGGAALPPSATAATLRRAAAELERRERPFFRSCAPLARAEPREAAALLRRVAAQLEADGG
LNWGRLLALVVFAGTLAAALAERGCGEGPRRLAEALAAYLAEERGEWLREHGGWDGFCRFFGRHGSQPADQNSTISNAIM
AAAGFGIAGLAFLLVVR
© 1998-2022Legal notice