Dataset for protein Unclassified of organism Astyanax mexicanus

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A8B9JCX1_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Astyanax mexicanus (length=147 residues).
MSCWLRKETLALAEDYIRFCTGDQRTPPSESAEAMRRLAKEMERQHHSKFHSLSQSFLTACGADPSACLRSVMAVLVEDG
KLNWGRVVSLFTFTGVLATELFSRGDGPECCSRLAETIADYLGAENKEWLLENEGWWKNHRMVHKTF
>gnl|bcl2dbpro|W5LAB6_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Astyanax mexicanus (length=176 residues).
MSCWLRKETLALAEDYIRFCTGDQRTPPSESAEAMRRLAKEMERQHHSKFHSLSQSFLTACGADPSACLRSVMAVLVEDG
KLNWGRVVSLFTFTGVLATELFSRGDGPECCSRLAETIADYLGAENKEWLLENEGWEGFCKFVRRAGHLGQDSSMKTALF
AAAGVGIAGLTFLLVR
© 1998-2022Legal notice