Dataset for protein Unclassified of organism Anas zonorhyncha

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8B9VPR7_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Anas zonorhyncha (length=151 residues).
MPGSLKEETALLLQDYFQHRGGGTALPPSATAATLRRAAAELERRERPFFRSCAPLXXXXXXXXXXXXXXXXXXXXLGAV
WGRGSLARYLLEGACFRRPSGSACACKQDGFCRFFGRHGSQPADQNSTISNAIMAAAGFGIAGLAFLLVVR
© 1998-2022Legal notice