Dataset for protein Unclassified of organism Anas platyrhynchos

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8B9SL62_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Anas platyrhynchos (length=177 residues).
MPGSLKEETALLLQDYFQHRGGGTALPPSATAATLRRAAAELERRERPFFRSCAPLARAEPREAAALLRRVAAQLEADGG
LNWGRLLALVVFAGTLAAALAERGCGDGPHRLAEALAAYLAEERGEWLREHGGWDGFCRFFGRHGSQPADQNSTISNAIM
AAAGFGIAGLAFLLVVR
© 1998-2023Legal notice