Dataset for protein Unclassified of organism Anas platyrhynchos platyrhynchos

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A493T3B4_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Anas platyrhynchos platyrhynchos (length=89 residues).
LVVFAGTLAAALAERGCGDGPHRLAEALAAYLAEERGEWLREHGGWDGFCRFFGRHGSQPADQNSTISNAIMAAAGFGIA
GLAFLLVVR
© 1998-2020Legal notice